PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.19046s0037.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 703aa    MW: 78781.8 Da    PI: 6.1835
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.19046s0037.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox611.8e-192979656
                          S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox  6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                          ++t++q+++Le++F+++++p++++r++L ++l+L+ +q+k+WFqN+R++ k
  Bostr.19046s0037.1.p 29 RHTPQQIQRLEAYFKECPHPDESQRQQLCQELKLEADQIKFWFQNKRTQSK 79
                          689*********************************************988 PP

2START115.38.7e-372184383206
                           HHHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS.....SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S... CS
                 START   3 aeeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv....dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                           a +a +el ++ l ee++Wvkss       +se +++  + ++   +     ++e +++ +vv+ ++++l e +ld+  +W+e ++   
  Bostr.19046s0037.1.p 218 AASAVEELKRLFLTEEQFWVKSSidgtymiDSESYEKFSYAVKH--FrstsAHVESSKDGTVVPTEATNLIEMFLDSE-KWKELFPtiv 303
                           667889999999***********999888866666666666633..255778**************************.******9999 PP

                           .EEEEEEEECTT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEE CS
                 START  78 .kaetlevissg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepk 157
                            ka+t+ v+          ++lq+   +l  lsplvp R+f++vR++++  +g w+i+dvS +++ +   ++s+    ++pSg+li+++
  Bostr.19046s0037.1.p 304 nKAKTIHVLGLElpirencNVLQVLWEQLHILSPLVPpREFMIVRCCQEIDKGLWIIADVSHSVNFDFV-NASC---YKRPSGCLIQTL 388
                           9********999999999********************************************9998888.4555...559********* PP

                           CTCEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                 START 158 snghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                           +n hskv w+ehv+++ +l  h ++r l++ g   gak+w  tl+r ce+
  Bostr.19046s0037.1.p 389 PNAHSKVMWIEHVEVDHKLDtHKIYRELLSGGSGYGAKRWIVTLKRMCER 438
                           *******************99***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-191082IPR009057Homeodomain-like
SuperFamilySSF466893.38E-171181IPR009057Homeodomain-like
PROSITE profilePS5007115.7422181IPR001356Homeobox domain
SMARTSM003897.3E-152385IPR001356Homeobox domain
CDDcd000861.47E-152881No hitNo description
PfamPF000464.6E-172979IPR001356Homeobox domain
PROSITE profilePS5084839.256207441IPR002913START domain
SuperFamilySSF559617.97E-26209439No hitNo description
CDDcd088754.25E-88212437No hitNo description
SMARTSM002342.7E-20216438IPR002913START domain
PfamPF018521.6E-30218438IPR002913START domain
Gene3DG3DSA:3.30.530.204.5E-5273408IPR023393START-like domain
SuperFamilySSF559618.93E-9458667No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 703 aa     Download sequence    Send to blast
MDNDGGGSSG NEQYTSEDAK QNGKKICHRH TPQQIQRLEA YFKECPHPDE SQRQQLCQEL  60
KLEADQIKFW FQNKRTQSKA QDERCTNILL RGENENLQSE NEAMLEALNN VICPACGGPP  120
FGREEREHNL QKLRLENARL KEQRDKISNF VSKHMSKRPI VGDSLASVPS QQIFDHLSYG  180
SNPSNIFEPS SSLGPPTSQT IQPQPLSQMD ISLLSETAAS AVEELKRLFL TEEQFWVKSS  240
IDGTYMIDSE SYEKFSYAVK HFRSTSAHVE SSKDGTVVPT EATNLIEMFL DSEKWKELFP  300
TIVNKAKTIH VLGLELPIRE NCNVLQVLWE QLHILSPLVP PREFMIVRCC QEIDKGLWII  360
ADVSHSVNFD FVNASCYKRP SGCLIQTLPN AHSKVMWIEH VEVDHKLDTH KIYRELLSGG  420
SGYGAKRWIV TLKRMCERMA LSSIPTLPAS DWSEVITTGE GRRSVMKLGE RMLKNFNEML  480
TMSGKVDFPQ QSKCGVRVSI RMNLEAGQPP GFVVSAASSL SIPLTPLQVF IFLRNLDTRQ  540
QWDVLSYGTV VSEIARIATG SSETNCLTIL RVHPTQEENN DKLMARDSDK EDMLMLQDCY  600
MDALGGMIVY APMDMATMKI AVSGEVDPSH IPILPSGFII SSDGRRSTAE DGGTLLTVAF  660
QILISGKTTR SREVNERSVD TVSALISSTV QRIKGLLNCP QC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1178670.0AK117867.1 Arabidopsis thaliana At3g03260 mRNA for unknown protein, complete cds, clone: RAFL19-04-D14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_186976.20.0homeobox-leucine zipper protein HDG8
SwissprotQ9M9P40.0HDG8_ARATH; Homeobox-leucine zipper protein HDG8
TrEMBLR0HRS60.0R0HRS6_9BRAS; Uncharacterized protein
STRINGAT3G03260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM127911530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03260.10.0homeodomain GLABROUS 8